DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and AT4G12600

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001190705.1 Gene:AT4G12600 / 826873 AraportID:AT4G12600 Length:183 Species:Arabidopsis thaliana


Alignment Length:180 Identity:88/180 - (48%)
Similarity:109/180 - (60%) Gaps:55/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EEVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEILLH 67
            |.|||||:||||:||:..|::|:|||.||.||:|||||||||||||:::.:|:|.|.||:|||||
plant     4 EGVNPKAYPLADSQLSITILDLVQQATNYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLH 68

  Fly    68 LPLLCEDK-------------------------------------------------------NV 77
            ||||.|||                                                       ||
plant    69 LPLLAEDKVFEFLLIVSLSYESQLVVSLALASFTGFTWVSSSYDKKIRLYWLLDSSFEIVIVDNV 133

  Fly    78 PYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIERLLV 127
            |||||.|||||||||.|:||::|||||:||.|||||||..::..||:||:
plant   134 PYVFVPSKQALGRACDVTRPVIACSVTSNEASQLKSQIQHLKDAIEKLLI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 85/175 (49%)
AT4G12600NP_001190705.1 Ribosomal_L7Ae 22..166 CDD:279573 65/143 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3672
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62158
OrthoDB 1 1.010 - - D1497609at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1617
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.