DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and RSRC1

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001258767.1 Gene:RSRC1 / 51319 HGNCID:24152 Length:334 Species:Homo sapiens


Alignment Length:137 Identity:30/137 - (21%)
Similarity:52/137 - (37%) Gaps:25/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EEVNPKA----FPLADAQLTAKIMNLLQQALNYNQLRK----GANEATKTLNRGLADIVVLAGDA 59
            |..|.||    .|.|: |..|::..:|:.|...::..|    ...||.:......|.:|      
Human   166 ESGNIKAGLEHLPPAE-QAKARLQLVLEAAAKADEALKAKERNEEEAKRRKEEDQATLV------ 223

  Fly    60 EPIEILLHLPLLCEDKNVPYVFVRSKQA--------LGRACGVSRPIVACSVTTNEGSQLKSQIT 116
            |.::.:..:..:..|..|...|..||:.        :.:|...|.|  |.:|.....::.:...|
Human   224 EQVKRVKEIEAIESDSFVQQTFRSSKEVKKSVEPSEVKQATSTSGP--ASAVADPPSTEKEIDPT 286

  Fly   117 SIQQEIE 123
            ||...|:
Human   287 SIPTAIK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 29/134 (22%)
RSRC1NP_001258767.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..179 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..220 3/18 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..290 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.