DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and gadd45g

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001004986.1 Gene:gadd45g / 448442 XenbaseID:XB-GENE-481955 Length:159 Species:Xenopus tropicalis


Alignment Length:110 Identity:24/110 - (21%)
Similarity:43/110 - (39%) Gaps:20/110 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ADAQLTA--KIMNLLQQALNYNQLRKGANEATKTLNRGLADIV--VLAG---DAEPIEILLHLPL 70
            ||...||  .:..||..|.....|..|..|:.|.:|.....:.  :||.   |...|.:.:|..|
 Frog    16 ADRMQTAGKALHELLVSAQREECLTVGVYESAKVMNVDPDSVTFCILAADEYDEGDIALQIHFTL 80

  Fly    71 L---CEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLK 112
            :   |.:.::..|.:...:.:.:..|:          |:|.::.|
 Frog    81 IQAFCCENDINIVRLNDTEKVAQILGL----------TDESAEPK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 24/110 (22%)
gadd45gNP_001004986.1 Ribosomal_L7Ae 24..>107 CDD:321063 16/82 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.