DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and NHP2

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster


Alignment Length:122 Identity:43/122 - (35%)
Similarity:66/122 - (54%) Gaps:3/122 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VNPKAFPLADAQLTAKIMNLLQQALNYNQ-LRKGANEATKTLNRGLADIVVLAGDAEPIEILLHL 68
            ||..|.|:|..:|..|...|:::|:.:.. ||.|..:....|.:|...|.:.|||..|::|:.||
  Fly    37 VNAIAKPMAGKKLAKKCYKLVKKAMKHKTFLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHL 101

  Fly    69 PLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIERL 125
            |.:||:|.:||.:..|:..||.|.||.|..||..|..||  :.|.....:::|:..|
  Fly   102 PAVCEEKGIPYTYTPSRADLGAAMGVKRGTVALLVRQNE--EYKDLYDEVKEELSAL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 42/121 (35%)
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23105
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.