DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and rpp38

DIOPT Version :10

Sequence 1:NP_524714.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001002525.2 Gene:rpp38 / 436798 ZFINID:ZDB-GENE-040718-258 Length:265 Species:Danio rerio


Alignment Length:108 Identity:31/108 - (28%)
Similarity:39/108 - (36%) Gaps:24/108 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TEEVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEILL 66
            |||.||.:.|....|........|  ||. .||..|.||.||.|.|....:|::.....|..:..
Zfish    81 TEEQNPASEPAESVQTPEPGWTNL--ALR-KQLAIGINEVTKGLERNELSLVLVCNSVTPAHMTS 142

  Fly    67 HLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGS 109
            ||..|.:.::||                     ||.|....||
Zfish   143 HLIPLSKTRSVP---------------------ACQVPGLSGS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_524714.1 SNU13 6..127 CDD:411046 28/104 (27%)
rpp38NP_001002525.2 Ribosomal_L7Ae 108..178 CDD:426153 21/78 (27%)

Return to query results.
Submit another query.