powered by:
Protein Alignment hoip and RpL10Aa
DIOPT Version :9
Sequence 1: | NP_001260293.1 |
Gene: | hoip / 44173 |
FlyBaseID: | FBgn0286786 |
Length: | 127 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_650410.1 |
Gene: | RpL10Aa / 41811 |
FlyBaseID: | FBgn0038281 |
Length: | 216 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 12/47 - (25%) |
Similarity: | 20/47 - (42%) |
Gaps: | 10/47 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 RACGVSRPIVACSVTTNEGSQLKSQIT----------SIQQEIERLL 126
:|.||....|......|:..:|..::: ||.::|.|||
Fly 78 KAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLL 124
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR23105 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.