DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and gadd45ba

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_998196.1 Gene:gadd45ba / 406304 ZFINID:ZDB-GENE-040426-1971 Length:159 Species:Danio rerio


Alignment Length:110 Identity:29/110 - (26%)
Similarity:42/110 - (38%) Gaps:22/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLQQALNYNQLRKGANEATKTLNRGLADIVVLA------GDAEPIEILLHLPLL---CEDKNVPY 79
            ||..|...:.|..|..|:.|.:|.. .|.|||.      .|.:.|.:.:|..||   |.|.::..
Zfish    26 LLVAAQRQDCLTVGVYESAKLMNVD-PDCVVLCILATDEEDLDDIALQIHFTLLQAFCCDNDINI 89

  Fly    80 VFVRSKQALGRACGVSRPIVA---------CSVTTNEGSQ-LKSQ 114
            :.|...:.|.:.  :..|...         |.:.||...| ||.|
Zfish    90 LRVSGLRRLAQV--LDEPATVENSEPRDFHCILVTNSQCQPLKCQ 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 29/110 (26%)
gadd45baNP_998196.1 Ribosomal_L7Ae 21..109 CDD:279573 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.