DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and RpS12

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster


Alignment Length:107 Identity:26/107 - (24%)
Similarity:48/107 - (44%) Gaps:10/107 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PKAFPLADA--QLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEILLHLP 69
            |.|.|:.|.  .:...:..:|:::|..:.|..|.::|.|.|::..|.:.:||...:.......:.
  Fly     9 PSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVT 73

  Fly    70 LLCEDKNVPYVFVRSKQALGRACGV--------SRPIVACSV 103
            .||.:..:|.:.|.|.:.||...|:        .|.:..|||
  Fly    74 ALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 26/107 (24%)
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.