DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and snu13

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_988994.1 Gene:snu13 / 394590 XenbaseID:XB-GENE-963821 Length:128 Species:Xenopus tropicalis


Alignment Length:128 Identity:101/128 - (78%)
Similarity:116/128 - (90%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTE-EVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEI 64
            ||| ||||||:||||||||..:::|:|||.||.||||||||||||||||:|:.:|:|.||||:||
 Frog     1 MTEPEVNPKAYPLADAQLTKTLLDLVQQAANYKQLRKGANEATKTLNRGIAEFIVMAADAEPLEI 65

  Fly    65 LLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIERLLV 127
            :||||||||||||||||||||||||||||||||::||:||..||||||.||.|:||.||||||
 Frog    66 ILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACAVTIKEGSQLKPQIQSLQQSIERLLV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 94/120 (78%)
snu13NP_988994.1 Rpl7Ae 9..103 CDD:224277 74/93 (80%)
Interaction with U4 snRNA and U4atac snRNA. /evidence=ECO:0000250|UniProtKB:P55769 36..48 11/11 (100%)
Important for U4 snRNA-binding. /evidence=ECO:0000250|UniProtKB:P55769 96..128 22/31 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4210
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3672
Inparanoid 1 1.050 206 1.000 Inparanoid score I3624
OMA 1 1.010 - - QHG62158
OrthoDB 1 1.010 - - D1497609at2759
OrthoFinder 1 1.000 - - FOG0002761
OrthoInspector 1 1.000 - - oto105090
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1366
SonicParanoid 1 1.000 - - X1617
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.