DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and nhp2

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_988989.1 Gene:nhp2 / 394586 XenbaseID:XB-GENE-973261 Length:149 Species:Xenopus tropicalis


Alignment Length:106 Identity:43/106 - (40%)
Similarity:64/106 - (60%) Gaps:0/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEILLHLP 69
            :||.|.|||..:||.|:...:::|:....:|:|..|..|.:|:|...|||:|||..|||:..|:|
 Frog    27 LNPIAKPLAGRKLTKKLYKCVKKAIKQKNIRRGVKEVQKFINKGEKGIVVMAGDTLPIEVYCHIP 91

  Fly    70 LLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQ 110
            ::|||:.:||.:|.||..||.|.|..||.....:..:|..|
 Frog    92 VMCEDRGIPYSYVPSKSDLGAAAGSKRPTCVILIKPHEDYQ 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 43/105 (41%)
nhp2NP_988989.1 Ribosomal_L7Ae 41..135 CDD:366537 35/92 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.