DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and RGD1566078

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:XP_038956542.1 Gene:RGD1566078 / 363514 RGDID:1566078 Length:128 Species:Rattus norvegicus


Alignment Length:128 Identity:96/128 - (75%)
Similarity:112/128 - (87%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTE-EVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEI 64
            ||| :|||||:|||||.||.|:.:|:||:.||.||||||||.|||||||:::.:|:|.||||:||
  Rat     1 MTEADVNPKAYPLADAHLTKKLQDLVQQSSNYKQLRKGANEDTKTLNRGVSEFIVMAADAEPLEI 65

  Fly    65 LLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIERLLV 127
            :|||||||||||||||||.||||||||.|||||::|||||..||||||.||.||||.||:|||
  Rat    66 ILHLPLLCEDKNVPYVFVHSKQALGRARGVSRPVIACSVTIKEGSQLKQQIQSIQQSIEQLLV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 90/120 (75%)
RGD1566078XP_038956542.1 SNU13 7..113 CDD:411046 79/105 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353227
Domainoid 1 1.000 156 1.000 Domainoid score I4091
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3652
OMA 1 1.010 - - QHG62158
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002761
OrthoInspector 1 1.000 - - otm46201
orthoMCL 1 0.900 - - OOG6_101116
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1617
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.