DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and rpl7a

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_956341.1 Gene:rpl7a / 337010 ZFINID:ZDB-GENE-031001-9 Length:266 Species:Danio rerio


Alignment Length:90 Identity:30/90 - (33%)
Similarity:44/90 - (48%) Gaps:2/90 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LRKGANEATKTLNRGLADIVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPI 98
            ||.|.|..|..:....|.:||:|.|.:|||:::.||.||....|||..|:.|..|||.  |.|..
Zfish   136 LRAGVNTVTTLVESKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIVKGKARLGRL--VHRKT 198

  Fly    99 VACSVTTNEGSQLKSQITSIQQEIE 123
            ......|....:.|:.:..:.:.|:
Zfish   199 CTSIAFTQTNPEDKAALAKLVEAIK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 30/90 (33%)
rpl7aNP_956341.1 PTZ00365 12..266 CDD:240382 30/90 (33%)
Ribosomal_L7Ae 13..252 CDD:294400 30/90 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.