DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and snu13b

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_955829.1 Gene:snu13b / 321114 ZFINID:ZDB-GENE-030131-9670 Length:128 Species:Danio rerio


Alignment Length:128 Identity:98/128 - (76%)
Similarity:113/128 - (88%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTE-EVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEI 64
            ||| ||||||:|||||.|:..|::|:|||.||.||||||||||||||||:::.:|:|.||||:||
Zfish     1 MTEAEVNPKAYPLADATLSKTILDLVQQASNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEI 65

  Fly    65 LLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIERLLV 127
            :||||||||||||||||||||||||||||||||::|.|||..||||||.||.|:|..||||||
Zfish    66 ILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIATSVTIKEGSQLKPQIQSVQMAIERLLV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 91/120 (76%)
snu13bNP_955829.1 SNU13 7..128 CDD:411046 91/120 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595314
Domainoid 1 1.000 152 1.000 Domainoid score I4293
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3672
Inparanoid 1 1.050 197 1.000 Inparanoid score I3785
OMA 1 1.010 - - QHG62158
OrthoDB 1 1.010 - - D1497609at2759
OrthoFinder 1 1.000 - - FOG0002761
OrthoInspector 1 1.000 - - otm25245
orthoMCL 1 0.900 - - OOG6_101116
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1366
SonicParanoid 1 1.000 - - X1617
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 1 1.500 - -
1717.300

Return to query results.
Submit another query.