DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and RGD1561102

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001100247.1 Gene:RGD1561102 / 299713 RGDID:1561102 Length:132 Species:Rattus norvegicus


Alignment Length:110 Identity:28/110 - (25%)
Similarity:52/110 - (47%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAE-PIEILLHLPLLCEDKNVPYVFVRS 84
            :..:|:.||.::.|.:|.:||.|.|.:..|.:.|||.:.: |:.|.| :..||.:..:..:.|..
  Rat    18 LQEVLKTALVHDGLARGIHEAAKALGKRQAHLCVLAANCDKPMYIKL-VETLCAEHQINLIKVDD 81

  Fly    85 KQALGRACGV--------SRPIVACSVTTNEGSQLKSQITSIQQE 121
            .:.||...|:        .|.::.||....:....:||...:.:|
  Rat    82 NKKLGEWVGLCKIDRKGKPRKVIGCSCVVVKDYGQESQAKDVIEE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 28/110 (25%)
RGD1561102NP_001100247.1 Ribosomal_L7Ae 16..111 CDD:279573 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.