DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and snu13

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_593592.1 Gene:snu13 / 2542663 PomBaseID:SPAC607.03c Length:125 Species:Schizosaccharomyces pombe


Alignment Length:123 Identity:87/123 - (70%)
Similarity:106/123 - (86%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEILLHLP 69
            ||||||||||:.||.:|::|:|||.:|.||||||||||||||||:::.:|:|.|.||||||||||
pombe     3 VNPKAFPLADSGLTQQILDLVQQASHYKQLRKGANEATKTLNRGISEFIVMAADTEPIEILLHLP 67

  Fly    70 LLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIERLLV 127
            |||||||||||||.||.|||||||||||:::.|:||||.|.|..||.:|:..||:||:
pombe    68 LLCEDKNVPYVFVPSKAALGRACGVSRPVISASITTNEASDLLPQIQAIKLAIEKLLI 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 85/120 (71%)
snu13NP_593592.1 Rpl7Ae 6..117 CDD:224277 79/110 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 144 1.000 Domainoid score I1159
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3672
Inparanoid 1 1.050 181 1.000 Inparanoid score I1122
OMA 1 1.010 - - QHG62158
OrthoFinder 1 1.000 - - FOG0002761
OrthoInspector 1 1.000 - - oto101930
orthoMCL 1 0.900 - - OOG6_101116
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1366
SonicParanoid 1 1.000 - - X1617
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.