DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and Dock4

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:XP_006515148.1 Gene:Dock4 / 238130 MGIID:1918006 Length:1980 Species:Mus musculus


Alignment Length:65 Identity:12/65 - (18%)
Similarity:28/65 - (43%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIE 123
            |.|:......|.:|.:.....:.....:.:.|...:|.|.|....:::..||..:::::|..:.|
Mouse  1607 ASPVHFPNGSPRVCRNSAPASMSPDGTRVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSE 1671

  Fly   124  123
            Mouse  1672  1671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 12/65 (18%)
Dock4XP_006515148.1 SH3_DOCK4_B 10..65 CDD:212982
DOCK_N 69..392 CDD:374409
C2_Dock-B 400..584 CDD:176077
DHR2_DOCK4 1206..1596 CDD:212578
Atrophin-1 <1731..>1937 CDD:367360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.