DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and Rpp38

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:XP_030105367.1 Gene:Rpp38 / 227522 MGIID:2443607 Length:350 Species:Mus musculus


Alignment Length:100 Identity:23/100 - (23%)
Similarity:36/100 - (36%) Gaps:20/100 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QLRKGANEATKTLNRGLADIVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSR- 96
            ||..|.||.|:.|.|....:|::....:|..|..||..|...:.||            ||.|.: 
Mouse   177 QLVIGVNEVTRALERNELLLVLVCKSVKPAIITSHLIQLSLSRTVP------------ACQVPQL 229

  Fly    97 -----PIVACSVTTNEGSQLKSQITSIQQEIERLL 126
                 |::........|  .:........|:|.::
Mouse   230 SERIAPVIGLKCVLALG--FRKNTRDFADEVEAII 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 23/99 (23%)
Rpp38XP_030105367.1 Ribosomal_L7Ae 172..250 CDD:366537 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.