DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and rpl-7A

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_741371.2 Gene:rpl-7A / 177203 WormBaseID:WBGene00004419 Length:265 Species:Caenorhabditis elegans


Alignment Length:91 Identity:30/91 - (32%)
Similarity:47/91 - (51%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NQLRKGANEATKTLNRGLADIVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSR 96
            |.:|.|.|..|:.:....|.:|::|.|..|:||:||||.||...||||..::.|.:||..  |.|
 Worm   135 NTVRHGVNTITRLVETRRAQLVLIAHDVNPLEIVLHLPALCRKYNVPYAIIKGKASLGTV--VRR 197

  Fly    97 PIVACSVTTNEGSQLKSQITSIQQEI 122
            ...|.....:...:.||.:..:.:.:
 Worm   198 KTTAAVALVDVNPEDKSALNKLVETV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 30/91 (33%)
rpl-7ANP_741371.2 PTZ00365 20..264 CDD:240382 30/91 (33%)
Ribosomal_L7Ae 33..264 CDD:294400 30/91 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.