DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and Y48A6B.3

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_499415.1 Gene:Y48A6B.3 / 176531 WormBaseID:WBGene00012964 Length:163 Species:Caenorhabditis elegans


Alignment Length:128 Identity:42/128 - (32%)
Similarity:68/128 - (53%) Gaps:3/128 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTEEVNPKAFPLADAQLTAKIMNLLQQA-LNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEI 64
            :.|.|||.|.|||:.:|..|:..|:::| .....||:|..:..|.|.|....|.:|||:..||::
 Worm    35 LCELVNPIAQPLANRKLAKKVYKLIKKASAGDKTLREGIKDVQKELRRNEKGICILAGNVSPIDV 99

  Fly    65 LLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIERLLV 127
            ..|:|.:||:|.:|||::.|::.||.|.|..||.:.  :........|.....:.:.:..|.|
 Worm   100 YSHIPGICEEKEIPYVYIPSREQLGLAVGHRRPSIL--IFVKPSGDFKELYDEVAEALRHLTV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 39/121 (32%)
Y48A6B.3NP_499415.1 Ribosomal_L7Ae 53..148 CDD:279573 31/96 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.