DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and LOC100359574

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:XP_008758813.1 Gene:LOC100359574 / 100359574 RGDID:2323620 Length:128 Species:Rattus norvegicus


Alignment Length:128 Identity:100/128 - (78%)
Similarity:116/128 - (90%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTE-EVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEI 64
            ||| :|||||:|||||.||.|:::|:||:.||.||||||||||||||||:::.:|:|.||||:||
  Rat     1 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEI 65

  Fly    65 LLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIERLLV 127
            :||||||||||||||||||||||||||||||||::|||||..||||||.||.||||.||||||
  Rat    66 ILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 94/120 (78%)
LOC100359574XP_008758813.1 SNU13 7..128 CDD:411046 94/120 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353226
Domainoid 1 1.000 156 1.000 Domainoid score I4091
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3672
Inparanoid 1 1.050 205 1.000 Inparanoid score I3652
OMA 1 1.010 - - QHG62158
OrthoDB 1 1.010 - - D1497609at2759
OrthoFinder 1 1.000 - - FOG0002761
OrthoInspector 1 1.000 - - otm46201
orthoMCL 1 0.900 - - OOG6_101116
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1617
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.