DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and YPT52

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_012939.1 Gene:YPT52 / 853884 SGDID:S000001722 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:70/198 - (35%)
Similarity:115/198 - (58%) Gaps:33/198 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IEGKVLVLGSRGVGKTRLVIRYIKNTLHR-KESEVPTIAVSFFTCNIIL--------DEVKIKLQ 59
            ::.|:::||...|||:.:|.|::|:|... :||   ||..:|.:.:|.:        .:|.||.:
Yeast     2 LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRES---TIGAAFLSQSITIHPNDGNETKDVVIKFE 63

  Fly    60 IWDTAGQERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNV-QDPMILTLVGNKMD 123
            ||||||||||:::|||||||||||::|:|:||..:..:.::|:.||...| .|.:::.|:|||:|
Yeast    64 IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVD 128

  Fly   124 M--------------------QAQRAVSREEAFVFATSIGATYFETSTETDQGLEQVFISTAQGL 168
            :                    |..||:|.|||..:|...|..:.|.|.:|.:|::::|....:.|
Yeast   129 LCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIFQDIGEKL 193

  Fly   169 VRL 171
            ..|
Yeast   194 YDL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 68/188 (36%)
Rab 7..166 CDD:206640 68/188 (36%)
YPT52NP_012939.1 Rab5_related 3..194 CDD:206653 68/193 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106452
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.