DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and RAB2B

DIOPT Version :10

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_116235.2 Gene:RAB2B / 84932 HGNCID:20246 Length:216 Species:Homo sapiens


Alignment Length:173 Identity:64/173 - (36%)
Similarity:104/173 - (60%) Gaps:10/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVP----TIAVSFFTCNIILDEVKIKLQIWDTAGQE 67
            |.:::|..||||:.|::::......      |    ||.|.|....:.:|..:||||||||||||
Human     8 KYIIIGDTGVGKSCLLLQFTDKRFQ------PVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQE 66

  Fly    68 RYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSR 132
            .:|::...|||.|..|:||:|:|:.:||..:.||:::..::....|::.|:|||.|::::|.|.|
Human    67 SFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKR 131

  Fly   133 EEAFVFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEG 175
            ||...||...|..:.|||.:|...:|:.||:||:.:.|...:|
Human   132 EEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Rab 7..166 CDD:206640 61/162 (38%)
RAB2BNP_116235.2 PLN03108 1..216 CDD:178655 64/173 (37%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P61106 37..42 2/4 (50%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P61106 63..72 5/8 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..216
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.