DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab20

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001103005.1 Gene:Rab20 / 689377 RGDID:1593487 Length:232 Species:Rattus norvegicus


Alignment Length:235 Identity:62/235 - (26%)
Similarity:102/235 - (43%) Gaps:32/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGIEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAG 65
            ||..:||:::||...||||.|:.||::   .|....|.|:..:|:    :.......:.||||||
  Rat     1 MRKPDGKIVLLGDMNVGKTSLLQRYME---RRFPDTVSTVGGAFY----LKQWRSFNISIWDTAG 58

  Fly    66 QERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAV 130
            :|::..:..||.|.|.|.||.:|:...::..|::.....|.....:..:..:||||:|:..:|..
  Rat    59 REQFHGLGSMYCRGAAAIILTYDVNNPQSLFELEDRFLGLTETANNDCLFAIVGNKVDLTTERGP 123

  Fly   131 SREEAFVFATSIGATYFETSTETDQGLEQVFISTAQGL------VRLADEGKSPSLRS--FQSTD 187
            ...|....:...|      |..:.:..:||....|..|      .::.||.:.|....  |::: 
  Rat   124 EGGEKDQASGKTG------SCVSSKVPKQVHPEDAMALYKKILKYKMLDEREMPGAEQMCFETS- 181

  Fly   188 SLAYTNTN------TAFSHTVAALARSSGNAAFRLPYVDI 221
              |.|..|      |.|...|..:.|.....:  .|.|||
  Rat   182 --AKTGHNVDLLFETLFDLVVPMITRQKAEES--SPIVDI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 42/158 (27%)
Rab 7..166 CDD:206640 42/158 (27%)
Rab20NP_001103005.1 Rab20 7..231 CDD:133326 59/229 (26%)
Ras 7..195 CDD:278499 51/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.