DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab32

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_080681.1 Gene:Rab32 / 67844 MGIID:1915094 Length:223 Species:Mus musculus


Alignment Length:181 Identity:57/181 - (31%)
Similarity:92/181 - (50%) Gaps:14/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESE--VPTIAVSFFTCNIILD-EVKIKLQIWDTAGQER 68
            ||||:|..|||||.::.||:    |:..|:  ..||.|.|....:..| ...::||:||.|||||
Mouse    25 KVLVIGELGVGKTSIIKRYV----HQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQER 85

  Fly    69 YRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQ----DPMILTLVGNKMDMQAQRA 129
            :..:..:||:.|..|.:|||:::..||..:..|..:|...|.    .|:...|:.||.|.:...:
Mouse    86 FGNMTRVYYKEALGAFVVFDISRSSTFDAVLKWKNDLDSKVHLPNGSPIPAVLLANKCDQKKDNS 150

  Fly   130 VSREEAFVFATSIGAT-YFETSTETDQGLEQVFISTAQGLVRLADEGKSPS 179
            .|..:...|....|.| :||||.:.:..:::......:.:  ||::...||
Mouse   151 QSPSQMDQFCKDHGFTGWFETSAKDNINIDEATRFLVENM--LANQQSFPS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 53/166 (32%)
Rab 7..166 CDD:206640 53/166 (32%)
Rab32NP_080681.1 Rab32_Rab38 24..222 CDD:206692 57/181 (31%)
RAB 24..193 CDD:197555 54/173 (31%)
Effector region. /evidence=ECO:0000250 52..60 3/7 (43%)
PKA-RII subunit binding domain. /evidence=ECO:0000250 176..195 2/20 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12203
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.