DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and rab5d

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001025576.1 Gene:rab5d / 594964 XenbaseID:XB-GENE-489496 Length:213 Species:Xenopus tropicalis


Alignment Length:173 Identity:67/173 - (38%)
Similarity:110/173 - (63%) Gaps:4/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71
            |:::||...|||:.||:|::|...  .|.:..||..:|...::.||:..:|.:||||||||||.:
 Frog    21 KLVLLGDMAVGKSSLVLRFVKGQF--DEFQETTIGAAFLAQSVCLDDTTVKFEIWDTAGQERYHS 83

  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAF 136
            :||||||.|.|||:|||:|:.:||...|:|::||.|.....:::.|.|||.|:..:|.|..|||.
 Frog    84 LAPMYYRGAQAAIVVFDITKPETFDRAKAWVKELQRQASPNIVIALAGNKSDLAEKRMVEYEEAQ 148

  Fly   137 VFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEGKSPS 179
            .:|...|..:.|||.:|...:.::|::.|:.:.:  .:.::|:
 Frog   149 AYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPK--SDAQNPT 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 65/158 (41%)
Rab 7..166 CDD:206640 65/158 (41%)
rab5dNP_001025576.1 Rab5_related 19..181 CDD:206653 66/161 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.