DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and RAB5A

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_004153.2 Gene:RAB5A / 5868 HGNCID:9783 Length:215 Species:Homo sapiens


Alignment Length:176 Identity:69/176 - (39%)
Similarity:111/176 - (63%) Gaps:4/176 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71
            |:::||...|||:.||:|::|...|  |.:..||..:|.|..:.||:..:|.:||||||||||.:
Human    22 KLVLLGESAVGKSSLVLRFVKGQFH--EFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHS 84

  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAF 136
            :||||||.|.|||:|:|:|..::|...|:|::||.|.....:::.|.|||.|:..:|||..:||.
Human    85 LAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQ 149

  Fly   137 VFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEGKSPSLRS 182
            .:|......:.|||.:|...:.::|::.|:.|.:  :|.::|...|
Human   150 SYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPK--NEPQNPGANS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 64/158 (41%)
Rab 7..166 CDD:206640 64/158 (41%)
RAB5ANP_004153.2 Rab5_related 20..182 CDD:206653 65/161 (40%)
Effector region. /evidence=ECO:0000255 49..57 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..215 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.