DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and RAB22A

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_065724.1 Gene:RAB22A / 57403 HGNCID:9764 Length:194 Species:Homo sapiens


Alignment Length:181 Identity:68/181 - (37%)
Similarity:108/181 - (59%) Gaps:6/181 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERY 69
            |.||.:||..||||:.:|.|:::::.....:  |||..||.|..:.......|..|||||||||:
Human     5 ELKVCLLGDTGVGKSSIVWRFVEDSFDPNIN--PTIGASFMTKTVQYQNELHKFLIWDTAGQERF 67

  Fly    70 RAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREE 134
            ||:||||||.:.|||:|:|:|:.:||:.:|:|::||.::....:::.:.|||.|:...|.|...:
Human    68 RALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERD 132

  Fly   135 AFVFATSIGATYFETSTETDQGLEQVFISTAQGL----VRLADEGKSPSLR 181
            |..:|.||.|.:.|||.:....:.::||..::.:    ..|...||...||
Human   133 AKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 62/158 (39%)
Rab 7..166 CDD:206640 62/158 (39%)
RAB22ANP_065724.1 Rab5_related 5..167 CDD:206653 63/163 (39%)
Ras 7..167 CDD:278499 62/161 (39%)
Effector region. /evidence=ECO:0000250 34..42 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..194 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D579042at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.