DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and rab31

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_697248.2 Gene:rab31 / 568800 ZFINID:ZDB-GENE-140106-13 Length:194 Species:Danio rerio


Alignment Length:157 Identity:62/157 - (39%)
Similarity:96/157 - (61%) Gaps:2/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERY 69
            |.||.:||..||||:.:|.|::::  |...:..|||..||.|..:.......|..|||||||||:
Zfish     5 ELKVCLLGDTGVGKSSIVCRFVQD--HFDHNISPTIGASFLTKTVPSGNELHKFLIWDTAGQERF 67

  Fly    70 RAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREE 134
            .::||||||.:.||::|:|:|:..:|..:|.|::||..:..:.:::.:.|||.|:...|.|..:|
Zfish    68 HSLAPMYYRGSAAAVIVYDITKLDSFQTLKKWVKELKEHGPEDIVVAIAGNKNDLGDIREVPTKE 132

  Fly   135 AFVFATSIGATYFETSTETDQGLEQVF 161
            |..||.||.|.:.|||......:|::|
Zfish   133 AKEFAESIAAIFMETSARNAVNIEELF 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 61/155 (39%)
Rab 7..166 CDD:206640 61/155 (39%)
rab31XP_697248.2 Rab5_related 5..167 CDD:206653 62/157 (39%)
Ras 7..167 CDD:278499 61/155 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D579042at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.