Sequence 1: | NP_524713.1 | Gene: | RabX1 / 44172 | FlyBaseID: | FBgn0015372 | Length: | 261 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060287.1 | Gene: | RAB20 / 55647 | HGNCID: | 18260 | Length: | 234 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 59/236 - (25%) |
---|---|---|---|
Similarity: | 98/236 - (41%) | Gaps: | 53/236 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MRGIEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAG 65
Fly 66 QERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAV 130
Fly 131 SREEAFVFATSIGATYFETSTETDQG-------LEQVFISTAQGL------VRLADEGKSPSLRS 182
Fly 183 --FQSTDSLAYTNTNTAF-------------------SHTV 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX1 | NP_524713.1 | Ras | 7..166 | CDD:278499 | 44/165 (27%) |
Rab | 7..166 | CDD:206640 | 44/165 (27%) | ||
RAB20 | NP_060287.1 | Rab20 | 6..233 | CDD:133326 | 57/231 (25%) |
Effector region. /evidence=ECO:0000250 | 33..41 | 2/7 (29%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 125..144 | 5/29 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 212..234 | 4/6 (67%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0092 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |