DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and RAB20

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_060287.1 Gene:RAB20 / 55647 HGNCID:18260 Length:234 Species:Homo sapiens


Alignment Length:236 Identity:59/236 - (25%)
Similarity:98/236 - (41%) Gaps:53/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGIEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAG 65
            ||..:.|:::||...||||.|:.||::   .|....|.|:..:|:    :.......:.||||||
Human     1 MRKPDSKIVLLGDMNVGKTSLLQRYME---RRFPDTVSTVGGAFY----LKQWRSYNISIWDTAG 58

  Fly    66 QERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAV 130
            :|::..:..||.|.|.|.||.:|:...::..|::.....|........:..:||||:|:..:.|:
Human    59 REQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGAL 123

  Fly   131 SREEAFVFATSIGATYFETSTETDQG-------LEQVFISTAQGL------VRLADEGKSPSLRS 182
            :.:|.           .|.|...|.|       .:||.:..|..|      .::.||...|:...
Human   124 AGQEK-----------EECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQ 177

  Fly   183 --FQSTDSLAYTNTNTAF-------------------SHTV 202
              |:::....| |.:..|                   ||||
Human   178 MCFETSAKTGY-NVDLLFETLFDLVVPMILQQRAERPSHTV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 44/165 (27%)
Rab 7..166 CDD:206640 44/165 (27%)
RAB20NP_060287.1 Rab20 6..233 CDD:133326 57/231 (25%)
Effector region. /evidence=ECO:0000250 33..41 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..144 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..234 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.