DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab23

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster


Alignment Length:212 Identity:64/212 - (30%)
Similarity:103/212 - (48%) Gaps:9/212 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71
            ||:::|:.||||:.::.||.|....:...:  ||.|.|....|.:|...:::.:|||||||.:..
  Fly    39 KVVIVGNGGVGKSSMIQRYCKGIFTKDYKK--TIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDC 101

  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQD-PMILTLVGNKMDMQAQRAVSREEA 135
            :...|||.|.|::|||..|...:|..||.|.:::.....: |.:  :|.||:|:..|..|:.:|.
  Fly   102 ITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTV--IVQNKIDLIEQAVVTADEV 164

  Fly   136 FVFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEGKSPSLRSFQSTDSLAYTNTNT--AF 198
            ...|..:......||.:.|..:..||...|....:|..:.......:.|::....|::|.|  ||
  Fly   165 ETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSHPPYSSTPTISAF 229

  Fly   199 SHTVAALARSSGNAAFR 215
            |.|..  ..|||....|
  Fly   230 SPTFT--KSSSGTIVLR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 50/159 (31%)
Rab 7..166 CDD:206640 50/159 (31%)
Rab23NP_649574.1 Ras 50..199 CDD:278499 45/152 (30%)
Rab23_like 50..197 CDD:133306 45/150 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.