DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab26

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:215 Identity:74/215 - (34%)
Similarity:116/215 - (53%) Gaps:26/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVP-----TIAVSFFTCNIILDEVKIKLQIWDT 63
            |.|||::||..|||||.|:||:      |....||     |:.:.|....:::|..::|||||||
  Fly   211 IMGKVIMLGDSGVGKTSLLIRF------RDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDT 269

  Fly    64 AGQERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQ-AQ 127
            |||||:|:|...|||:|:|.:|::|:|...|:..|::|:.|:....|:.:::.|:|||.|.. ::
  Fly   270 AGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSE 334

  Fly   128 RAVSREEAFVFATSIGATYFETSTETDQGLEQVFISTAQGL----VRLADEGKSPSLRSFQSTDS 188
            |.|.||:...........:.|||.:|...:|..|.:.|:.|    ....|:||      |...| 
  Fly   335 RQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGK------FNVHD- 392

  Fly   189 LAYTNTNTAFSHTVAALARS 208
              :...||. :.:|.|..|:
  Fly   393 --FVRDNTK-ARSVCAQCRN 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 60/164 (37%)
Rab 7..166 CDD:206640 60/164 (37%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 71/208 (34%)
RAB 214..378 CDD:197555 62/169 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.