DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and rab5ab

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_957264.1 Gene:rab5ab / 393945 ZFINID:ZDB-GENE-040122-3 Length:216 Species:Danio rerio


Alignment Length:162 Identity:64/162 - (39%)
Similarity:104/162 - (64%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71
            |:::||...|||:.||:|::|...|  |.:..||..:|.|..:.||:..:|.:||||||||||.:
Zfish    23 KLVLLGESAVGKSSLVLRFVKGQFH--EFQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHS 85

  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAF 136
            :||||||.|.|||:|:|:|..::|...|:|::||.|.....:::.|.|||.|:..:||:..::|.
Zfish    86 LAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQ 150

  Fly   137 VFATSIGATYFETSTETDQGLEQVFISTAQGL 168
            .:|......:.|||.:|...:.::|::.|:.|
Zfish   151 SYADDNSLLFMETSAKTSMNVSEIFMAIAKKL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 62/158 (39%)
Rab 7..166 CDD:206640 62/158 (39%)
rab5abNP_957264.1 Rab5_related 21..183 CDD:206653 64/162 (40%)
Ras 23..184 CDD:278499 64/162 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.