DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab22a

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_006235767.1 Gene:Rab22a / 366265 RGDID:1311959 Length:194 Species:Rattus norvegicus


Alignment Length:175 Identity:67/175 - (38%)
Similarity:107/175 - (61%) Gaps:5/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERY 69
            |.||.:||..||||:.:|.|:::::.....:  |||..||.|..:.......|..|||||||||:
  Rat     5 ELKVCLLGDTGVGKSSIVWRFVEDSFDPNIN--PTIGASFMTKTVQYQNELHKFLIWDTAGQERF 67

  Fly    70 RAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREE 134
            ||:||||||.:.|||:|:|:|:.:||:.:|:|::||.::....:::.:.|||.|:...|.|...:
  Rat    68 RALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKCDLTDVREVMERD 132

  Fly   135 AFVFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEGKSPS 179
            |..:|.||.|.:.|||.:....:.::||..::   ||.....||:
  Rat   133 AKDYADSIHAIFVETSAKNAININELFIEISR---RLPSTDASPA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 62/158 (39%)
Rab 7..166 CDD:206640 62/158 (39%)
Rab22aXP_006235767.1 Rab5_related 5..167 CDD:206653 64/166 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D579042at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.