DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab3

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster


Alignment Length:174 Identity:61/174 - (35%)
Similarity:97/174 - (55%) Gaps:6/174 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71
            |:|::|:..||||..:.||..::.  ..:.|.|:.:.|....:...:.::||||||||||||||.
  Fly    23 KLLIIGNSSVGKTSFLFRYADDSF--TSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRT 85

  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAF 136
            :...|||.|...||::|:|...:|..::.|:.::.....|...:.|||||.||:.||.:|.|...
  Fly    86 ITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGR 150

  Fly   137 VFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEGKSPSL 180
            ..|..:|..:||||.:.:..::.||    :.||.:..:..|.||
  Fly   151 QLADQLGVEFFETSAKENVNVKAVF----ERLVDIICDKMSESL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 56/158 (35%)
Rab 7..166 CDD:206640 56/158 (35%)
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 58/167 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.