DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab14

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster


Alignment Length:176 Identity:70/176 - (39%)
Similarity:107/176 - (60%) Gaps:14/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLV-----IRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQ 66
            |.:::|..||||:.|:     .:::.|..|       ||.|.|.|..|.:|:.||||||||||||
  Fly    37 KYIIIGDMGVGKSCLLHQFTEKKFMANCPH-------TIGVEFGTRIIEVDDKKIKLQIWDTAGQ 94

  Fly    67 ERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDP-MILTLVGNKMDMQAQRAV 130
            ||:|||...|||.|..|::|:|:|:..|:..:.||:.:. ||:.:| .::.|:|||.|:::.|.|
  Fly    95 ERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDT-RNLTNPSTVIFLIGNKSDLESTREV 158

  Fly   131 SREEAFVFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEGK 176
            :.|||..||...|..:.|.|..|.|.:|:.|:.||:.:.:...||:
  Fly   159 TYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 67/164 (41%)
Rab 7..166 CDD:206640 67/164 (41%)
Rab14NP_788056.1 Rab14 34..199 CDD:133322 68/169 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.