DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab6

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster


Alignment Length:173 Identity:56/173 - (32%)
Similarity:97/173 - (56%) Gaps:2/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71
            |::.||.:.||||.|:.|::.::.  ..:...||.:.|.:..:.|::..::||:||||||||:|:
  Fly    14 KLVFLGEQSVGKTSLITRFMYDSF--DNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRS 76

  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAF 136
            :.|.|.|::..|::|:|:|...:|.:...||.::.......:|:.|||||.|:..:|.||.||..
  Fly    77 LIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGE 141

  Fly   137 VFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEGKSPS 179
            ..|..:...:.|||.:....::|:|...|..|..:......||
  Fly   142 RKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 52/158 (33%)
Rab 7..166 CDD:206640 52/158 (33%)
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 53/160 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.