DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab5

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:189 Identity:70/189 - (37%)
Similarity:112/189 - (59%) Gaps:8/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71
            |:::||...|||:.||:|::|...|  |.:..||..:|.|..|.:::..:|.:||||||||||.:
  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93

  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAF 136
            :||||||.|.|||:|:|:....:|...|:|::|||:.....:::.|.|||.|:...|.|..:||.
  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAK 158

  Fly   137 VFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEGKSPSLRSFQSTDSLAYTNTN 195
            .:|...|..:.|||.:|...:..:|::.|:.|.:  ::|.:....|.:.|.    |.||
  Fly   159 QYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPK--NDGANNQGTSIRPTG----TETN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 62/158 (39%)
Rab 7..166 CDD:206640 62/158 (39%)
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 63/161 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454232
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.