DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and RAB37

DIOPT Version :10

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001006639.1 Gene:RAB37 / 326624 HGNCID:30268 Length:223 Species:Homo sapiens


Alignment Length:185 Identity:68/185 - (36%)
Similarity:110/185 - (59%) Gaps:5/185 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQER 68
            :.|||::||..|||||..:|:: |:......:.:.|:.:.|....:.:|.|::||||||||||||
Human    28 LTGKVMLLGDTGVGKTCFLIQF-KDGAFLSGTFIATVGIDFRNKVVTVDGVRVKLQIWDTAGQER 91

  Fly    69 YRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSRE 133
            :|:|...|||:|.|.:|::|:|...:|..|::|:.|:|...|..:::.|:|||.||.::|.:..|
Human    92 FRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMSSERVIRSE 156

  Fly   134 EAFVFATSIGATYFETSTETDQGLEQVFISTAQGL-VRLADEGKSPSLRSFQSTD 187
            :....|...|..:.|||.:|...:|..|::.|:.| .|...:...|   |||..|
Human   157 DGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEP---SFQIRD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Rab 7..166 CDD:206640 59/158 (37%)
RAB37NP_001006639.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Rab26 31..220 CDD:206695 67/182 (37%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 52..67 1/14 (7%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 85..102 11/16 (69%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.