DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab27

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:221 Identity:65/221 - (29%)
Similarity:100/221 - (45%) Gaps:43/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGIEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILD----EVKIKLQIW 61
            :.|...:.||||..|||||.|:.:|.....|.:  .:.|:.:.|....::.:    ..:|.||||
  Fly    13 LAGSGEQFLVLGDSGVGKTCLLYQYTDGRFHTQ--FISTVGIDFREKRLLYNSRGRRHRIHLQIW 75

  Fly    62 DTAGQERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQEL--HRNVQDPMILTLVGNKMDM 124
            |||||||:|::...:||:|...:|:||||..|:|.|..:|:.:|  |...:||.:: |.|||.|:
  Fly    76 DTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVV-LCGNKCDL 139

  Fly   125 QAQRAVSREEAFVFATSIGATYFETSTETDQGLEQ------------------------------ 159
            ...|.|||::...........|.|||..|...:::                              
  Fly   140 LQLRVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREFSLLLTQSR 204

  Fly   160 ----VFISTAQGLVRLADEGKSPSLR 181
                :.....:.||||.|..:.|..|
  Fly   205 CLPNIAYGQPEDLVRLHDRREEPCSR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 57/198 (29%)
Rab 7..166 CDD:206640 57/198 (29%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 57/170 (34%)
RAB 20..186 CDD:197555 57/168 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.