Sequence 1: | NP_524713.1 | Gene: | RabX1 / 44172 | FlyBaseID: | FBgn0015372 | Length: | 261 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_726743.1 | Gene: | Rab27 / 31103 | FlyBaseID: | FBgn0025382 | Length: | 236 | Species: | Drosophila melanogaster |
Alignment Length: | 221 | Identity: | 65/221 - (29%) |
---|---|---|---|
Similarity: | 100/221 - (45%) | Gaps: | 43/221 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MRGIEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILD----EVKIKLQIW 61
Fly 62 DTAGQERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQEL--HRNVQDPMILTLVGNKMDM 124
Fly 125 QAQRAVSREEAFVFATSIGATYFETSTETDQGLEQ------------------------------ 159
Fly 160 ----VFISTAQGLVRLADEGKSPSLR 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX1 | NP_524713.1 | Ras | 7..166 | CDD:278499 | 57/198 (29%) |
Rab | 7..166 | CDD:206640 | 57/198 (29%) | ||
Rab27 | NP_726743.1 | P-loop_NTPase | 19..187 | CDD:304359 | 57/170 (34%) |
RAB | 20..186 | CDD:197555 | 57/168 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45454455 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |