DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab21

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001004238.1 Gene:Rab21 / 299799 RGDID:1303150 Length:223 Species:Rattus norvegicus


Alignment Length:175 Identity:69/175 - (39%)
Similarity:117/175 - (66%) Gaps:4/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RGIEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQ 66
            |....||::||...||||.||:||.:|..:.|  .:.|:..||.|..:.:...::.|.|||||||
  Rat    14 RAYSFKVVLLGEGCVGKTSLVLRYCENKFNDK--HITTLQASFLTKKLNIGGKRVNLAIWDTAGQ 76

  Fly    67 ERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVS 131
            ||:.|:.|:|||::|.||||:|:|...:|.::|:|::||.:.:.:.:.|.:||||:|::.:|.||
  Rat    77 ERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVS 141

  Fly   132 REEAFVFATSIGATYFETSTETDQGLEQVFISTAQGLVRLA--DE 174
            .:||..:|.|:||.::.||.:.::|:|::|:...:.::..|  ||
  Rat   142 IQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 65/158 (41%)
Rab 7..166 CDD:206640 65/158 (41%)
Rab21NP_001004238.1 Rab21 18..179 CDD:133323 65/162 (40%)
Effector region. /evidence=ECO:0000250 46..54 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226895at2759
OrthoFinder 1 1.000 - - FOG0006095
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4390
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.