DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and RAB26

DIOPT Version :10

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_055168.2 Gene:RAB26 / 25837 HGNCID:14259 Length:256 Species:Homo sapiens


Alignment Length:181 Identity:67/181 - (37%)
Similarity:110/181 - (60%) Gaps:3/181 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71
            ||:::|..|||||.|::|: |:......:.:.|:.:.|....:.:|.||:|||:||||||||:|:
Human    65 KVMLVGDSGVGKTCLLVRF-KDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERFRS 128

  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAF 136
            |...|||:|:|.:|::|:|...:|..|::|:.|:|...|..:.|.|:|||:|...:|.|.||:..
Human   129 VTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGE 193

  Fly   137 VFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEGKSPSLRSFQSTD 187
            ..|...|..:.|||.:|...::..|.:.|:.|.:.:  .|:||...|:..|
Human   194 KLAKEYGLPFMETSAKTGLNVDLAFTAIAKELKQRS--MKAPSEPRFRLHD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Rab 7..166 CDD:206640 60/158 (38%)
RAB26NP_055168.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Rab26 64..254 CDD:206695 67/181 (37%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 86..101 1/14 (7%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 119..136 11/16 (69%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.