DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab31

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_659562.2 Gene:Rab31 / 246324 RGDID:628598 Length:195 Species:Rattus norvegicus


Alignment Length:166 Identity:64/166 - (38%)
Similarity:101/166 - (60%) Gaps:6/166 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERY 69
            |.||.:||..||||:.:|.|::::  |...:..|||..||.|..:.......|..|||||||||:
  Rat     6 ELKVCLLGDTGVGKSSIVCRFVQD--HFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERF 68

  Fly    70 RAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREE 134
            .::||||||.:.||::|:|:|:..:|..:|.|::||..:..:.:::.:.|||.|:...|.|..::
  Rat    69 HSLAPMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKD 133

  Fly   135 AFVFATSIGATYFETSTETDQGLEQVFISTAQGLVR 170
            |..:|.||||...|||.:....:|::|    ||:.|
  Rat   134 AKEYAESIGALVVETSAKNAINIEELF----QGISR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 60/158 (38%)
Rab 7..166 CDD:206640 60/158 (38%)
Rab31NP_659562.2 Rab5_related 6..168 CDD:206653 64/166 (39%)
Ras 8..168 CDD:278499 63/164 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D579042at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.