DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab24

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_006517228.1 Gene:Rab24 / 19336 MGIID:105065 Length:266 Species:Mus musculus


Alignment Length:176 Identity:63/176 - (35%)
Similarity:101/176 - (57%) Gaps:12/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVP---TIAVSFFTCNIILDEVKIKLQIWDTAG 65
            ::.||::||...||||.||.||:    |.:....|   ||..:|....:.:.:..:.|.||||||
Mouse     6 VDVKVVMLGKEYVGKTSLVERYV----HDRFLVGPYQNTIGAAFVAKVMCVGDRTVTLGIWDTAG 66

  Fly    66 QERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDM----QA 126
            .|||.|::.:|||.|.|||:.:|||...:|...|.|::|| |::::...:.|.|.|.|:    :.
Mouse    67 SERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKEL-RSLEEGCQIYLCGTKSDLLEEDRR 130

  Fly   127 QRAVSREEAFVFATSIGATYFETSTETDQGLEQVFISTAQGLVRLA 172
            :|.|...:...:|.:|.|..||||::|.|.::::|...|:..|.:|
Mouse   131 RRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 60/165 (36%)
Rab 7..166 CDD:206640 60/165 (36%)
Rab24XP_006517228.1 Rab24 8..183 CDD:133318 63/174 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.