DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and Rab17

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001153197.2 Gene:Rab17 / 19329 MGIID:104640 Length:214 Species:Mus musculus


Alignment Length:173 Identity:67/173 - (38%)
Similarity:110/173 - (63%) Gaps:5/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71
            |:::|||..||||.|.:||:|...   .:.:||:..:|||..:.|....:||:||||||||:|::
Mouse    21 KLVLLGSSSVGKTSLALRYMKQDF---SNVLPTVGCAFFTKVLDLGSSSLKLEIWDTAGQEKYQS 82

  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQ-DPMILTLVGNKMDMQAQRAVSREEA 135
            |..:|:|.||||:||:|:|:..:|.:.:.|:::|.:..| ..:::.|||||.|:..:|.|:.:|.
Mouse    83 VCHLYFRGANAALLVYDITRKDSFHKAQQWLEDLEKEFQPGEVVVMLVGNKTDLGEEREVTFQEG 147

  Fly   136 FVFATSIGATYFETSTETDQGLEQVFISTAQGLV-RLADEGKS 177
            ..||.|....:.|||.:.:..:.::|.:.||.|: |..|.|.|
Mouse   148 KEFAESKSLLFMETSAKLNYQVSEIFNTVAQELLQRAGDTGSS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 60/159 (38%)
Rab 7..166 CDD:206640 60/159 (38%)
Rab17NP_001153197.2 Rab5_related 21..181 CDD:206653 62/162 (38%)
Effector region. /evidence=ECO:0000250 47..55 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..204 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.