DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and C56E6.2

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_495318.2 Gene:C56E6.2 / 174077 WormBaseID:WBGene00016970 Length:266 Species:Caenorhabditis elegans


Alignment Length:154 Identity:60/154 - (38%)
Similarity:95/154 - (61%) Gaps:9/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILD----EVKIKLQIWDTAG 65
            :.||:|||..|||||.::.|:.....:|..:  .||..||.:.::..|    |..::||:|||||
 Worm    52 KAKVVVLGDSGVGKTSIIYRHRYGAHYRPVN--ATIGASFVSFDVGADYRDREDVVRLQVWDTAG 114

  Fly    66 QERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRN--VQDPMILTLVGNKMDMQAQR 128
            |||:|.:.|||.|||:||::|:|:|...||.:::.|:::|.|:  .:|..:. |:|||.|:..:|
 Worm   115 QERFRCMVPMYMRNADAALIVYDVTDRNTFEDVEKWLKDLDRSSGTEDANVY-LIGNKTDLVEKR 178

  Fly   129 AVSREEAFVFATSIGATYFETSTE 152
            .|:..|....|..|.|.:||.|.:
 Worm   179 EVTEAEGKAMAAKINAKFFELSND 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 60/152 (39%)
Rab 7..166 CDD:206640 60/152 (39%)
C56E6.2NP_495318.2 Gem1 50..264 CDD:224025 60/154 (39%)
Rab 54..200 CDD:206640 59/148 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.