DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and rab-5

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_492481.1 Gene:rab-5 / 172755 WormBaseID:WBGene00004268 Length:208 Species:Caenorhabditis elegans


Alignment Length:167 Identity:68/167 - (40%)
Similarity:105/167 - (62%) Gaps:2/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RGIEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQ 66
            |..:.|:::||...|||:.||:|::|...|  |.:..||..:|.|..:.||:..||.:|||||||
 Worm    16 RTCQFKLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAFLTQTVCLDDATIKFEIWDTAGQ 78

  Fly    67 ERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVS 131
            |||.::||||||.|.|||:|:|:|..::|.:.|:|::||.|.....:::.|.|||.|:..:|.|.
 Worm    79 ERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQASPNIVMALAGNKADVANKRTVE 143

  Fly   132 REEAFVFATSIGATYFETSTETDQGLEQVFISTAQGL 168
            .|||..:|......:.|||.:|...:..:|::.|:.|
 Worm   144 YEEANAYAEDNALLFMETSAKTSMNVNDIFMAIAKKL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 65/158 (41%)
Rab 7..166 CDD:206640 65/158 (41%)
rab-5NP_492481.1 Rab5_related 19..181 CDD:206653 67/164 (41%)
Ras 21..181 CDD:278499 67/162 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.