DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX1 and RAB31

DIOPT Version :9

Sequence 1:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_016881017.1 Gene:RAB31 / 11031 HGNCID:9771 Length:248 Species:Homo sapiens


Alignment Length:156 Identity:59/156 - (37%)
Similarity:95/156 - (60%) Gaps:6/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRAVAPMYYRN 79
            ||||:.:|.|::::  |...:..|||..||.|..:.......|..|||||||||:.::||||||.
Human    69 GVGKSSIVCRFVQD--HFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRG 131

  Fly    80 ANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAFVFATSIGA 144
            :.||::|:|:|:..:|..:|.|::||..:..:.:::.:.|||.|:...|.|..::|..:|.||||
Human   132 SAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGA 196

  Fly   145 TYFETSTETDQGLEQVFISTAQGLVR 170
            ...|||.:....:|::|    ||:.|
Human   197 IVVETSAKNAINIEELF----QGISR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX1NP_524713.1 Ras 7..166 CDD:278499 56/150 (37%)
Rab 7..166 CDD:206640 56/150 (37%)
RAB31XP_016881017.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D579042at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.