DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sw and DYNC2I2

DIOPT Version :9

Sequence 1:NP_477075.2 Gene:sw / 44160 FlyBaseID:FBgn0003654 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_443076.2 Gene:DYNC2I2 / 89891 HGNCID:28296 Length:536 Species:Homo sapiens


Alignment Length:478 Identity:111/478 - (23%)
Similarity:185/478 - (38%) Gaps:115/478 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GLEWEDEFTDDEESSLQNLGNGFTSKLPPGYLTHGLPTVKDVAPAITPLEIKKETEVKKEVNELS 243
            |:.||.:       |.|               |..:.|....|.|...::.:.:||....|:...
Human    57 GIRWETK-------SCQ---------------TASIATASASAQARNHVDAQVQTEAPVPVSVQP 99

  Fly   244 EEQKQMIILSENFQRFVVRAGRVIERALSENVDIYTDYIGGGDSEEANDERSHARLSLNRVF--Y 306
            ..|..:..|:    .|:.|...::.|.|::|                  .:|||       |  :
Human   100 PSQYDIPRLA----AFLRRVEAMVIRELNKN------------------WQSHA-------FDGF 135

  Fly   307 DERWSKNRCITSMDWSTHFPELVVGSYHNNEESPNEPDGV-------------------VMVWN- 351
            :..|::.:.:.|..::..:|.......|....|.|....|                   |..|| 
Human   136 EVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNL 200

  Fly   352 --TKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAH 414
              ...:...|..|....|||:...|....|:.:.||.|||::::||....:...:.||.|:...|
Human   201 DRRDLRPQQPSAVVEVPSAVLCLAFHPTQPSHVAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTH 265

  Fly   415 THPVYCLQMV-----GTQNAHNVISISSDGKLCSW--------------SLDMLSQPQDT-LELQ 459
            |.||  .|:|     |..:...|:|:::|||:..|              :|.|...|:.| |:..
Human   266 TDPV--SQVVWLPEPGHSHRFQVLSVATDGKVLLWQGIGVGQLQLTEGFALVMQQLPRSTKLKKH 328

  Fly   460 QRQSKAIAITSMAFPANEINSLVMGSEDGYVYSASRHG-------------LRSGVNEVYERHLG 511
            .|....:..|::||.:.:....::|:|.|:....|...             ||:.....:..|.|
Human   329 PRGETEVGATAVAFSSFDPRLFILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGG 393

  Fly   512 PITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSFEDNSDYVMDVAWSPVHPALFAA 576
            ||..:|     .||...:|||::..|..:.|:|:....||.|.:.:..|:..|.||||.|.:|||
Human   394 PIYSVS-----CSPFHRNLFLSAGTDGHVHLYSMLQAPPLTSLQLSLKYLFAVRWSPVRPLVFAA 453

  Fly   577 VDGSGRLDLWNLNQDTEVPTASI 599
            ..|.|.:.|::|.:.::.||..|
Human   454 ASGKGDVQLFDLQKSSQKPTVLI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
swNP_477075.2 Dynein_IC2 107..135 CDD:402922
WD40 316..632 CDD:421866 87/339 (26%)
WD40 repeat 316..365 CDD:293791 11/70 (16%)
WD40 repeat 371..409 CDD:293791 11/37 (30%)
WD40 repeat 418..457 CDD:293791 14/58 (24%)
WD40 repeat 469..555 CDD:293791 25/98 (26%)
WD40 repeat 561..599 CDD:293791 15/37 (41%)
WD40 repeat 607..633 CDD:293791
DYNC2I2NP_443076.2 DYNLL2 binding. /evidence=ECO:0000269|PubMed:30649997 80..93 2/12 (17%)
WD40 106..516 CDD:225201 98/407 (24%)
DYNLRB1 binding. /evidence=ECO:0000269|PubMed:30649997 106..131 7/46 (15%)
WD40 repeat 164..215 CDD:293791 8/50 (16%)
WD 1. /evidence=ECO:0000255 215..255 12/39 (31%)
WD40 217..515 CDD:295369 76/267 (28%)
WD40 repeat 220..264 CDD:293791 13/43 (30%)
WD 2. /evidence=ECO:0000255 264..308 13/45 (29%)
WD40 repeat 270..325 CDD:293791 13/54 (24%)
WD40 repeat 337..389 CDD:293791 9/51 (18%)
WD 3. /evidence=ECO:0000255 390..430 15/44 (34%)
WD40 repeat 396..432 CDD:293791 12/40 (30%)
WD 4. /evidence=ECO:0000255 433..473 14/39 (36%)
WD40 repeat 438..476 CDD:293791 15/37 (41%)
WD 5. /evidence=ECO:0000255 480..520
WD40 repeat 485..512 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453532at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.