DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sw and FY

DIOPT Version :9

Sequence 1:NP_477075.2 Gene:sw / 44160 FlyBaseID:FBgn0003654 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001318555.1 Gene:FY / 831191 AraportID:AT5G13480 Length:657 Species:Arabidopsis thaliana


Alignment Length:354 Identity:84/354 - (23%)
Similarity:123/354 - (34%) Gaps:85/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 HARLSLNRVFYDERWSKNRC-ITSMDWSTHFPELVVGSYHNNEESPNEPDGVVMVWNTKFKKSTP 359
            ||  |||         |||| |..:.|:.....|:.||          ..|...:||.  :....
plant   127 HA--SLN---------KNRCSINRVLWTPSGRRLITGS----------QSGEFTLWNG--QSFNF 168

  Fly   360 EDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQMV 424
            |.:.......:.:.....|.|.::.|...|.:..|.|.      :.....:..||...:..|...
plant   169 EMILQAHDQPIRSMVWSHNENYMVSGDDGGTLKYWQNN------MNNVKANKTAHKESIRDLSFC 227

  Fly   425 GTQNAHNVISISSDGKLCSWSLDMLSQPQDTLELQQRQSKAIAITSMAFPANEI------NSLVM 483
            .|           |.|.||.|.|...:..|..:.....|    :|...:....:      :.||.
plant   228 KT-----------DLKFCSCSDDTTVKVWDFTKCVDESS----LTGHGWDVKSVDWHPTKSLLVS 277

  Fly   484 GSEDGYVYSASRHGLRSGVNEVYERHLGPITG-----ISTHYNQLSPDFGHLFLTSSIDWTIKLW 543
            |.:|..|   .....|||      |.|..:.|     :|..:||    .|:..||:|.|..|||:
plant   278 GGKDQLV---KLWDTRSG------RELCSLHGHKNIVLSVKWNQ----NGNWLLTASKDQIIKLY 329

  Fly   544 SLKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRLDLW---NLNQDTEVPTASIVVAGAP 605
            .::..|.|.||..::..|..:||.|.|...|.:....|.:..|   :.|...|:|.|..      
plant   330 DIRTMKELQSFRGHTKDVTSLAWHPCHEEYFVSGSSDGSICHWIVGHENPQIEIPNAHD------ 388

  Fly   606 ALNRV---SWTPSGLHVCIG--DEAGKLY 629
              |.|   :|.|.|..:|.|  |...|.:
plant   389 --NSVWDLAWHPIGYLLCSGSNDHTTKFW 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
swNP_477075.2 Dynein_IC2 107..135 CDD:402922
WD40 316..632 CDD:421866 75/333 (23%)
WD40 repeat 316..365 CDD:293791 9/48 (19%)
WD40 repeat 371..409 CDD:293791 6/37 (16%)
WD40 repeat 418..457 CDD:293791 9/38 (24%)
WD40 repeat 469..555 CDD:293791 26/96 (27%)
WD40 repeat 561..599 CDD:293791 12/40 (30%)
WD40 repeat 607..633 CDD:293791 9/28 (32%)
FYNP_001318555.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.