DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and CYTIP

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_004279.3 Gene:CYTIP / 9595 HGNCID:9506 Length:359 Species:Homo sapiens


Alignment Length:215 Identity:53/215 - (24%)
Similarity:85/215 - (39%) Gaps:56/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TPPTLPPG-----VTKTCHI------------VKRPDFDGYGFNLHSEKVKPGQ--------FIG 50
            |..|||.|     :|::..:            |::.|.:.:||.:.|.:.:...        .|.
Human    48 TVATLPRGRKQLALTRSSSLSDFSWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLIC 112

  Fly    51 KVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKALEVKPASP 115
            |:..||||..|||:.||.:..:||||....|:||||..|::..|   ||.|:.....:.:|....
Human   113 KIQEDSPAHCAGLQAGDVLANINGVSTEGFTYKQVVDLIRSSGN---LLTIETLNGTMILKRTEL 174

  Fly   116 PAAACNGNGSASQNGYEGTKQEMP------GASANISSI-------------------SMVSTKR 155
            .|.......:..|...|....::.      |.:||..|:                   ::|...|
Human   175 EAKLQVLKQTLKQKWVEYRSLQLQEHRLLHGDAANCPSLENMDLDELSLFGPLPGPGPALVDRNR 239

  Fly   156 SSNASSIQ---SGSTMNASD 172
            .|:.||.:   |..||::.|
Human   240 LSSESSCKSWLSSMTMDSED 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 30/100 (30%)
CYTIPNP_004279.3 PDZ_signaling 76..161 CDD:238492 29/87 (33%)
Interaction with CYTH1 166..188 2/21 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.